PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C00722.1.p
Common NameEUGRSUZ_C00722, LOC104436343
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 291aa    MW: 32374 Da    PI: 4.756
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C00722.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.4e-181562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT++Ed++l d++k +G g W+ I+++ g++R++k+c++rw++yl
  Eucgr.C00722.1.p 15 RGAWTADEDKRLTDYIKVHGEGKWRNIPKRAGLKRCGKSCRLRWLNYL 62
                      89********************************************97 PP

2Myb_DNA-binding50.25.8e-1668112147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+ T +E++l+++++++lG++ W++Ia +++ gRt++++k++w++ 
  Eucgr.C00722.1.p  68 RGNITSDEEDLIIRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNST 112
                       7999******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.881066IPR017930Myb domain
SuperFamilySSF466893.29E-2913109IPR009057Homeodomain-like
SMARTSM007173.2E-141464IPR001005SANT/Myb domain
PfamPF002494.1E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-231669IPR009057Homeodomain-like
CDDcd001675.83E-111762No hitNo description
PROSITE profilePS5129419.50967117IPR017930Myb domain
SMARTSM007171.0E-1467115IPR001005SANT/Myb domain
PfamPF002494.5E-1468112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2370115IPR009057Homeodomain-like
CDDcd001672.02E-1072113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGRSPCCSKD EGLNRGAWTA DEDKRLTDYI KVHGEGKWRN IPKRAGLKRC GKSCRLRWLN  60
YLRPDIKRGN ITSDEEDLII RLHRLLGNRW SLIAGRLPGR TDNEIKNYWN STLAKREQGE  120
KKPSLSTTEK INPMATSSIM QDETQNLVLV GDSTLHHMEQ PSGTSEAAKS GQSSEYESSD  180
VSSPASMSRE EPNLEPLMVD CTVGELDLVE ILDASDFRLN ESGNTSQVMN TVDNEGMSKN  240
ENVGGTSYGQ AHNWWSEGLE MDNWVSDLAE MTSGLGPFAS ILYGTEDWIP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-271311625127MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C00722.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010047390.10.0PREDICTED: anthocyanin regulatory C1 protein-like
SwissprotP102906e-64MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A059CM240.0A0A059CM24_EUCGR; Uncharacterized protein
STRINGVIT_04s0008g01820.t016e-72(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.13e-60myb domain protein 7